Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli

Artikelnummer: BIM-RPC20417
Artikelname: Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli
Artikelnummer: BIM-RPC20417
Hersteller Artikelnummer: RPC20417
Alternativnummer: BIM-RPC20417-20UG,BIM-RPC20417-100UG,BIM-RPC20417-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Porcine
Konjugation: Unconjugated
Alternative Synonym: Epididymis-specific glutathione peroxidase-like proteinEGLP
Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: GPX5. Target Synonyms: Epididymis-specific glutathione peroxidase-like proteinEGLP. Accession Number: O18994. Expression Region: 22~219aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Target-Kategorie: GPX5