Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli

Catalog Number: BIM-RPC20417
Article Name: Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20417
Supplier Catalog Number: RPC20417
Alternative Catalog Number: BIM-RPC20417-20UG,BIM-RPC20417-100UG,BIM-RPC20417-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Porcine
Conjugation: Unconjugated
Alternative Names: Epididymis-specific glutathione peroxidase-like proteinEGLP
Recombinant Pig Epididymal secretory glutathione peroxidase (GPX5) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Pig (Sus scrofa, Porcine). Target Name: GPX5. Target Synonyms: Epididymis-specific glutathione peroxidase-like proteinEGLP. Accession Number: O18994. Expression Region: 22~219aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 27.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.6kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: NSNLEKMDCYKDVTGTIYDYDAFTLNGNEHIQFKQYAGKHVLFVNVATYCGLTAQYPELNTLQEELKPFGLVVLGFPCNQFGKQEPGENSEILLGLKYVRPGGGYVPNFQLFEKGDVNGEKEQKVFTFLKHSCPHPSELIGSIGYISWEPIRVHDIRWNFEKFLVGPDGVPVMRWVHETPISTVKSDILAYLKQFKTE
Target: GPX5