Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot), Unconjugated, E. coli

Artikelnummer: BIM-RPC20433
Artikelname: Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot), Unconjugated, E. coli
Artikelnummer: BIM-RPC20433
Hersteller Artikelnummer: RPC20433
Alternativnummer: BIM-RPC20433-20UG,BIM-RPC20433-100UG,BIM-RPC20433-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Zonular occludens toxinZot
Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961). Target Name: zot. Target Synonyms: Zonular occludens toxinZot. Accession Number: P38442. Expression Region: 1~399aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 48.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 48.4kDa
Tag: N-Terminal 10Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSIFIHHGAPGSYKTSGALWLRLLPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPESFEVAFDMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKFTLTTHDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKDRKILFLFGMVFLMFSYSFYGLHDNPIFTGGN
Target-Kategorie: zot