Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot), Unconjugated, E. coli

Catalog Number: BIM-RPC20433
Article Name: Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20433
Supplier Catalog Number: RPC20433
Alternative Catalog Number: BIM-RPC20433-20UG,BIM-RPC20433-100UG,BIM-RPC20433-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Zonular occludens toxinZot
Recombinant Vibrio cholerae serotype O1 Zona occludens toxin (zot) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961). Target Name: zot. Target Synonyms: Zonular occludens toxinZot. Accession Number: P38442. Expression Region: 1~399aa. Tag Info: N-Terminal 10Xhis-Tagged. Theoretical MW: 48.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 48.4kDa
Tag: N-Terminal 10Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSIFIHHGAPGSYKTSGALWLRLLPAIKSGRHIITNVRGLNLERMAKYLKMDVSDISIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLKALDTPPDLVAEDRPESFEVAFDMHRHHGWDICLTTPNIAKVHNMIREAAEIGYRHFNRATVGLGAKFTLTTHDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALWKDRKILFLFGMVFLMFSYSFYGLHDNPIFTGGN
Target: zot