Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase, Unconjugated, E. coli

Artikelnummer: BIM-RPC20444
Artikelname: Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase, Unconjugated, E. coli
Artikelnummer: BIM-RPC20444
Hersteller Artikelnummer: RPC20444
Alternativnummer: BIM-RPC20444-20UG,BIM-RPC20444-100UG,BIM-RPC20444-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Invertebrate
Konjugation: Unconjugated
Alternative Synonym: Renilla-type luciferase
Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Renilla reniformis (Sea pansy). Target Name: Renilla reniformis Coelenterazine h 2-monooxygenase. Target Synonyms: Renilla-type luciferase. Accession Number: P27652. Expression Region: 1~311aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKMFI
Target-Kategorie: Renilla reniformis Coelenterazine h 2-monooxygenase