Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase, Unconjugated, E. coli

Catalog Number: BIM-RPC20444
Article Name: Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20444
Supplier Catalog Number: RPC20444
Alternative Catalog Number: BIM-RPC20444-20UG,BIM-RPC20444-100UG,BIM-RPC20444-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Invertebrate
Conjugation: Unconjugated
Alternative Names: Renilla-type luciferase
Recombinant Renilla reniformis Coelenterazine h 2-monooxygenase is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Renilla reniformis (Sea pansy). Target Name: Renilla reniformis Coelenterazine h 2-monooxygenase. Target Synonyms: Renilla-type luciferase. Accession Number: P27652. Expression Region: 1~311aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 56kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTSKVYDPEQRKRMITGPQWWARCKQMNVLDSFINYYDSEKHAENAVIFLHGNAASSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGACLAFHYSYEHQDKIKAIVHAESVVDVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETMLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKMFI
Target: Renilla reniformis Coelenterazine h 2-monooxygenase