Recombinant Human Histone deacetylase 6 (HDAC6), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC20451
Artikelname: Recombinant Human Histone deacetylase 6 (HDAC6), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC20451
Hersteller Artikelnummer: RPC20451
Alternativnummer: BIM-RPC20451-20UG,BIM-RPC20451-100UG,BIM-RPC20451-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CPBHM, FLJ16239, HD 6, HD6, HDAC 6, HDAC6, HDAC6_HUMAN, Histone deacetylase 6 (HD6), Histone deacetylase 6, JM 21, JM21, KIAA0901, OTTHUMP00000032398, OTTHUMP00000197663, PPP1R90, Protein phosphatase 1 regulatory subunit 90
Recombinant Human Histone deacetylase 6 (HDAC6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HDAC6. Target Synonyms: CPBHM, FLJ16239, HD 6, HD6, HDAC 6, HDAC6, HDAC6_HUMAN, Histone deacetylase 6 (HD6), Histone deacetylase 6, JM 21, JM21, KIAA0901, OTTHUMP00000032398, OTTHUMP00000197663, PPP1R90, Protein phosphatase 1 regulatory subunit 90. Accession Number: Q9UBN7. Expression Region: 1~488aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 70.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 70.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVH
Target-Kategorie: HDAC6