Recombinant Human Histone deacetylase 6 (HDAC6), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC20451
Article Name: Recombinant Human Histone deacetylase 6 (HDAC6), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20451
Supplier Catalog Number: RPC20451
Alternative Catalog Number: BIM-RPC20451-20UG,BIM-RPC20451-100UG,BIM-RPC20451-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CPBHM, FLJ16239, HD 6, HD6, HDAC 6, HDAC6, HDAC6_HUMAN, Histone deacetylase 6 (HD6), Histone deacetylase 6, JM 21, JM21, KIAA0901, OTTHUMP00000032398, OTTHUMP00000197663, PPP1R90, Protein phosphatase 1 regulatory subunit 90
Recombinant Human Histone deacetylase 6 (HDAC6), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: HDAC6. Target Synonyms: CPBHM, FLJ16239, HD 6, HD6, HDAC 6, HDAC6, HDAC6_HUMAN, Histone deacetylase 6 (HD6), Histone deacetylase 6, JM 21, JM21, KIAA0901, OTTHUMP00000032398, OTTHUMP00000197663, PPP1R90, Protein phosphatase 1 regulatory subunit 90. Accession Number: Q9UBN7. Expression Region: 1~488aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 70.1kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 70.1kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVH
Target: HDAC6