Recombinant Sheep Interleukin-4 (IL4), Unconjugated, E. coli

Artikelnummer: BIM-RPC20454
Artikelname: Recombinant Sheep Interleukin-4 (IL4), Unconjugated, E. coli
Artikelnummer: BIM-RPC20454
Hersteller Artikelnummer: RPC20454
Alternativnummer: BIM-RPC20454-20UG,BIM-RPC20454-100UG,BIM-RPC20454-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Sheep
Konjugation: Unconjugated
Alternative Synonym: B-cell stimulatory factor 1
Recombinant Sheep Interleukin-4 (IL4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries). Target Name: IL4. Target Synonyms: B-cell stimulatory factor 1. Accession Number: P30368. Expression Region: 25~135aa. Tag Info: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29.6kDa
Tag: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Target-Kategorie: IL4