Recombinant Sheep Interleukin-4 (IL4), Unconjugated, E. coli

Catalog Number: BIM-RPC20454
Article Name: Recombinant Sheep Interleukin-4 (IL4), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20454
Supplier Catalog Number: RPC20454
Alternative Catalog Number: BIM-RPC20454-20UG,BIM-RPC20454-100UG,BIM-RPC20454-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Sheep
Conjugation: Unconjugated
Alternative Names: B-cell stimulatory factor 1
Recombinant Sheep Interleukin-4 (IL4) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Sheep (Ovis aries). Target Name: IL4. Target Synonyms: B-cell stimulatory factor 1. Accession Number: P30368. Expression Region: 25~135aa. Tag Info: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 29.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29.6kDa
Tag: N-Terminal 10Xhis-B2M-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: HKCDITLEEIIKTLNILTSRKNSCMELPVADVFAAPKNATEKETFCRAGIELRRIYRSHMCLNKFLGGLDRNLSSLASKTCSVNEAKTSTSTLRDLLERLKTIMREKYSKC
Target: IL4