Recombinant Brucella abortus Malate dehydrogenase (mdh), Unconjugated, E. coli

Artikelnummer: BIM-RPC20473
Artikelname: Recombinant Brucella abortus Malate dehydrogenase (mdh), Unconjugated, E. coli
Artikelnummer: BIM-RPC20473
Hersteller Artikelnummer: RPC20473
Alternativnummer: BIM-RPC20473-20UG,BIM-RPC20473-100UG,BIM-RPC20473-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37
Recombinant Brucella abortus Malate dehydrogenase (mdh) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Brucella abortus (strain S19). Target Name: mdh. Target Synonyms: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37. Accession Number: B2S881. Expression Region: 1~320aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MARNKIALIGSGMIGGTLAHLAGLKELGDVVLFDIAEGTPQGKGLDIAESSPVDGFDAKFTGANDYAAIEGADVVIVTAGVPRKPGMSRDDLLGINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARFRYFLSEEFNVSVEDVTVFVLGGHGDSMVPLARYSTVAGIPLPDLVKMGWTSQDKLDKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVLP
Target-Kategorie: mdh