Recombinant Brucella abortus Malate dehydrogenase (mdh), Unconjugated, E. coli

Catalog Number: BIM-RPC20473
Article Name: Recombinant Brucella abortus Malate dehydrogenase (mdh), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20473
Supplier Catalog Number: RPC20473
Alternative Catalog Number: BIM-RPC20473-20UG,BIM-RPC20473-100UG,BIM-RPC20473-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37
Recombinant Brucella abortus Malate dehydrogenase (mdh) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Brucella abortus (strain S19). Target Name: mdh. Target Synonyms: mdh, BAbS19_I18080, Malate dehydrogenase, EC 1.1.1.37. Accession Number: B2S881. Expression Region: 1~320aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 53.7kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.7kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MARNKIALIGSGMIGGTLAHLAGLKELGDVVLFDIAEGTPQGKGLDIAESSPVDGFDAKFTGANDYAAIEGADVVIVTAGVPRKPGMSRDDLLGINLKVMEQVGAGIKKYAPEAFVICITNPLDAMVWALQKFSGLPAHKVVGMAGVLDSARFRYFLSEEFNVSVEDVTVFVLGGHGDSMVPLARYSTVAGIPLPDLVKMGWTSQDKLDKIIQRTRDGGAEIVGLLKTGSAFYAPAASAIQMAESYLKDKKRVLP
Target: mdh