Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B), Unconjugated, Yeast

Artikelnummer: BIM-RPC20504
Artikelname: Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B), Unconjugated, Yeast
Artikelnummer: BIM-RPC20504
Hersteller Artikelnummer: RPC20504
Alternativnummer: BIM-RPC20504-20UG,BIM-RPC20504-100UG,BIM-RPC20504-1MG
Hersteller: Biomatik Corporation
Wirt: Yeast
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271, HEL-S-271, Mitochondrial ATP synthase beta subunit, Mitochondrial ATP Synthase Subunit Beta, Mitochondrial ATP synthetase beta subunit
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5F1B. Target Synonyms: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271. Accession Number: P06576. Expression Region: 48~529aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 53.8kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVL
Target-Kategorie: ATP5F1B