Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B), Unconjugated, Yeast

Catalog Number: BIM-RPC20504
Article Name: Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B), Unconjugated, Yeast
Biozol Catalog Number: BIM-RPC20504
Supplier Catalog Number: RPC20504
Alternative Catalog Number: BIM-RPC20504-20UG,BIM-RPC20504-100UG,BIM-RPC20504-1MG
Manufacturer: Biomatik Corporation
Host: Yeast
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271, HEL-S-271, Mitochondrial ATP synthase beta subunit, Mitochondrial ATP Synthase Subunit Beta, Mitochondrial ATP synthetase beta subunit
Recombinant Human ATP synthase subunit beta, mitochondrial (ATP5F1B) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: Yeast. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: ATP5F1B. Target Synonyms: ATP 5B, ATP synthase H+ transporting mitochondrial F1 complex beta polypeptide, ATP synthase subunit beta mitochondrial, ATP synthase subunit beta, mitochondrial, atp5b, ATPB, ATPB_HUMAN, ATPMB, ATPSB, Epididymis secretory protein Li 271. Accession Number: P06576. Expression Region: 48~529aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 53.8kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 53.8kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: AQTSPSPKAGAATGRIVAVIGAVVDVQFDEGLPPILNALEVQGRETRLVLEVAQHLGESTVRTIAMDGTEGLVRGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAPIHAEAPEFMEMSVEQEILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVL
Target: ATP5F1B