Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), Unconjugated, E. coli

Artikelnummer: BIM-RPC20523
Artikelname: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), Unconjugated, E. coli
Artikelnummer: BIM-RPC20523
Hersteller Artikelnummer: RPC20523
Alternativnummer: BIM-RPC20523-20UG,BIM-RPC20523-100UG,BIM-RPC20523-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: CD67 antigenCarcinoembryonic antigen CGM6Non-specific cross-reacting antigen NCA-95CD_antigen: CD66b
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM8. Target Synonyms: CD67 antigenCarcinoembryonic antigen CGM6Non-specific cross-reacting antigen NCA-95CD_antigen: CD66b. Accession Number: P31997. Expression Region: 35~320aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 47.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 47.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNI
Target-Kategorie: CEACAM8