Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), Unconjugated, E. coli

Catalog Number: BIM-RPC20523
Article Name: Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20523
Supplier Catalog Number: RPC20523
Alternative Catalog Number: BIM-RPC20523-20UG,BIM-RPC20523-100UG,BIM-RPC20523-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: CD67 antigenCarcinoembryonic antigen CGM6Non-specific cross-reacting antigen NCA-95CD_antigen: CD66b
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8 (CEACAM8) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: CEACAM8. Target Synonyms: CD67 antigenCarcinoembryonic antigen CGM6Non-specific cross-reacting antigen NCA-95CD_antigen: CD66b. Accession Number: P31997. Expression Region: 35~320aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 47.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 47.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNI
Target: CEACAM8