Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD), Unconjugated, E. coli

Artikelnummer: BIM-RPC20544
Artikelname: Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD), Unconjugated, E. coli
Artikelnummer: BIM-RPC20544
Hersteller Artikelnummer: RPC20544
Alternativnummer: BIM-RPC20544-20UG,BIM-RPC20544-100UG,BIM-RPC20544-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: DCMC_HUMAN, hMCD, Malonyl CoA decarboxylase, Malonyl CoA decarboxylase mitochondrial, Malonyl coenzyme A decarboxylase, Malonyl-CoA decarboxylase, MCD, MGC59795, mitochondrial, Mlycd
Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MLYCD. Target Synonyms: DCMC_HUMAN, hMCD, Malonyl CoA decarboxylase, Malonyl CoA decarboxylase mitochondrial, Malonyl coenzyme A decarboxylase, Malonyl-CoA decarboxylase, MCD, MGC59795, mitochondrial, Mlycd. Accession Number: O95822. Expression Region: 40~493aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 55.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLT
Target-Kategorie: MLYCD