Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD), Unconjugated, E. coli

Catalog Number: BIM-RPC20544
Article Name: Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC20544
Supplier Catalog Number: RPC20544
Alternative Catalog Number: BIM-RPC20544-20UG,BIM-RPC20544-100UG,BIM-RPC20544-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: DCMC_HUMAN, hMCD, Malonyl CoA decarboxylase, Malonyl CoA decarboxylase mitochondrial, Malonyl coenzyme A decarboxylase, Malonyl-CoA decarboxylase, MCD, MGC59795, mitochondrial, Mlycd
Recombinant Human Malonyl-CoA decarboxylase, mitochondrial (MLYCD) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: MLYCD. Target Synonyms: DCMC_HUMAN, hMCD, Malonyl CoA decarboxylase, Malonyl CoA decarboxylase mitochondrial, Malonyl coenzyme A decarboxylase, Malonyl-CoA decarboxylase, MCD, MGC59795, mitochondrial, Mlycd. Accession Number: O95822. Expression Region: 40~493aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 55.9kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 55.9kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MDELLRRAVPPTPAYELREKTPAPAEGQCADFVSFYGGLAETAQRAELLGRLARGFGVDHGQVAEQSAGVLHLRQQQREAAVLLQAEDRLRYALVPRYRGLFHHISKLDGGVRFLVQLRADLLEAQALKLVEGPDVREMNGVLKGMLSEWFSSGFLNLERVTWHSPCEVLQKISEAEAVHPVKNWMDMKRRVGPYRRCYFFSHCSTPGEPLVVLHVALTGDISSNIQAIVKEHPPSETEEKNKITAAIFYSISLT
Target: MLYCD