Recombinant Human Fanconi anemia group C protein (FANCC), Unconjugated, E. coli

Artikelnummer: BIM-RPC21301
Artikelname: Recombinant Human Fanconi anemia group C protein (FANCC), Unconjugated, E. coli
Artikelnummer: BIM-RPC21301
Hersteller Artikelnummer: RPC21301
Alternativnummer: BIM-RPC21301-20UG,BIM-RPC21301-100UG,BIM-RPC21301-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Konjugation: Unconjugated
Alternative Synonym: bA80I15.1, FA 3, FA3, FAC, FACC, FANCC, FANCC_HUMAN, Fanconi anemia complementation group C, Fanconi anemia complementation group C protein, Fanconi anemia group C protein, Fanconi pancytopenia type 3, FLJ14675, Protein FACC
Recombinant Human Fanconi anemia group C protein (FANCC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FANCC. Target Synonyms: bA80I15.1, FA 3, FA3, FAC, FACC, FANCC, FANCC_HUMAN, Fanconi anemia complementation group C, Fanconi anemia complementation group C protein, Fanconi anemia group C protein, Fanconi pancytopenia type 3, FLJ14675, Protein FACC. Accession Number: Q00597. Expression Region: 1~558aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 79.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 79.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAML
Target-Kategorie: FANCC