Recombinant Human Fanconi anemia group C protein (FANCC), Unconjugated, E. coli

Catalog Number: BIM-RPC21301
Article Name: Recombinant Human Fanconi anemia group C protein (FANCC), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC21301
Supplier Catalog Number: RPC21301
Alternative Catalog Number: BIM-RPC21301-20UG,BIM-RPC21301-100UG,BIM-RPC21301-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Human
Conjugation: Unconjugated
Alternative Names: bA80I15.1, FA 3, FA3, FAC, FACC, FANCC, FANCC_HUMAN, Fanconi anemia complementation group C, Fanconi anemia complementation group C protein, Fanconi anemia group C protein, Fanconi pancytopenia type 3, FLJ14675, Protein FACC
Recombinant Human Fanconi anemia group C protein (FANCC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human (Homo sapiens). Target Name: FANCC. Target Synonyms: bA80I15.1, FA 3, FA3, FAC, FACC, FANCC, FANCC_HUMAN, Fanconi anemia complementation group C, Fanconi anemia complementation group C protein, Fanconi anemia group C protein, Fanconi pancytopenia type 3, FLJ14675, Protein FACC. Accession Number: Q00597. Expression Region: 1~558aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 79.4kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 79.4kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MAQDSVDLSCDYQFWMQKLSVWDQASTLETQQDTCLHVAQFQEFLRKMYEALKEMDSNTVIERFPTIGQLLAKACWNPFILAYDESQKILIWCLCCLINKEPQNSGQSKLNSWIQGVLSHILSALRFDKEVALFTQGLGYAPIDYYPGLLKNMVLSLASELRENHLNGFNTQRRMAPERVASLSRVCVPLITLTDVDPLVEALLICHGREPQEILQPEFFEAVNEAILLKKISLPMSAVVCLWLRHLPSLEKAML
Target: FANCC