Recombinant Human papillomavirus type 52 Protein E7 (E7), Unconjugated, E. coli

Artikelnummer: BIM-RPC22593
Artikelname: Recombinant Human papillomavirus type 52 Protein E7 (E7), Unconjugated, E. coli
Artikelnummer: BIM-RPC22593
Hersteller Artikelnummer: RPC22593
Alternativnummer: BIM-RPC22593-20UG,BIM-RPC22593-100UG,BIM-RPC22593-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: E7Protein E7
Recombinant Human papillomavirus type 52 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 52. Target Name: E7. Target Synonyms: E7Protein E7. Accession Number: P36831. Expression Region: 1~99aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL
Target-Kategorie: E7