Recombinant Human papillomavirus type 52 Protein E7 (E7), Unconjugated, E. coli

Catalog Number: BIM-RPC22593
Article Name: Recombinant Human papillomavirus type 52 Protein E7 (E7), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22593
Supplier Catalog Number: RPC22593
Alternative Catalog Number: BIM-RPC22593-20UG,BIM-RPC22593-100UG,BIM-RPC22593-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: E7Protein E7
Recombinant Human papillomavirus type 52 Protein E7 (E7) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human papillomavirus type 52. Target Name: E7. Target Synonyms: E7Protein E7. Accession Number: P36831. Expression Region: 1~99aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MRGDKATIKDYILDLQPETTDLHCYEQLGDSSDEEDTDGVDRPDGQAEQATSNYYIVTYCHSCDSTLRLCIHSTATDLRTLQQMLLGTLQVVCPGCARL
Target: E7