Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2), Unconjugated, E. coli

Artikelnummer: BIM-RPC22622
Artikelname: Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2), Unconjugated, E. coli
Artikelnummer: BIM-RPC22622
Hersteller Artikelnummer: RPC22622
Alternativnummer: BIM-RPC22622-20UG,BIM-RPC22622-100UG,BIM-RPC22622-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101
Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa). Target Name: LTP2. Target Synonyms: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101. Accession Number: P55958. Expression Region: 32~133aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 27.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Target-Kategorie: LTP2