Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2), Unconjugated, E. coli

Catalog Number: BIM-RPC22622
Article Name: Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22622
Supplier Catalog Number: RPC22622
Alternative Catalog Number: BIM-RPC22622-20UG,BIM-RPC22622-100UG,BIM-RPC22622-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101
Recombinant Parietaria judaica Probable non-specific lipid-transfer protein 2 (LTP2) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Parietaria judaica (Pellitory-of-the-wall) (Parietaria diffusa). Target Name: LTP2. Target Synonyms: Allergen Par j IIMajor pollen allergen Par j 2.0101Protein P2Allergen: Par j 2.0101. Accession Number: P55958. Expression Region: 32~133aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 27.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 27.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: EEACGKVVQDIMPCLHFVKGEEKEPSKECCSGTKKLSEEVKTTEQKREACKCIVRATKGISGIKNELVAEVPKKCDIKTTLPPITADFDCSKIQSTIFRGYY
Target: LTP2