Recombinant Androctonus australis Alpha-mammal toxin AaH2, Unconjugated, E. coli

Artikelnummer: BIM-RPC22662
Artikelname: Recombinant Androctonus australis Alpha-mammal toxin AaH2, Unconjugated, E. coli
Artikelnummer: BIM-RPC22662
Hersteller Artikelnummer: RPC22662
Alternativnummer: BIM-RPC22662-20UG,BIM-RPC22662-100UG,BIM-RPC22662-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Konjugation: Unconjugated
Alternative Synonym: AaH IIAaHIINeurotoxin 2
Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Androctonus australis (Sahara scorpion). Target Name: Androctonus australis Alpha-mammal toxin AaH2. Target Synonyms: AaH IIAaHIINeurotoxin 2. Accession Number: P01484. Expression Region: 20~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 23.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Target-Kategorie: Androctonus australis Alpha-mammal toxin AaH2