Recombinant Androctonus australis Alpha-mammal toxin AaH2, Unconjugated, E. coli

Catalog Number: BIM-RPC22662
Article Name: Recombinant Androctonus australis Alpha-mammal toxin AaH2, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22662
Supplier Catalog Number: RPC22662
Alternative Catalog Number: BIM-RPC22662-20UG,BIM-RPC22662-100UG,BIM-RPC22662-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Conjugation: Unconjugated
Alternative Names: AaH IIAaHIINeurotoxin 2
Recombinant Androctonus australis Alpha-mammal toxin AaH2 is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Androctonus australis (Sahara scorpion). Target Name: Androctonus australis Alpha-mammal toxin AaH2. Target Synonyms: AaH IIAaHIINeurotoxin 2. Accession Number: P01484. Expression Region: 20~83aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 23.3kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 23.3kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH
Target: Androctonus australis Alpha-mammal toxin AaH2