Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli

Artikelnummer: BIM-RPC22678
Artikelname: Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli
Artikelnummer: BIM-RPC22678
Hersteller Artikelnummer: RPC22678
Alternativnummer: BIM-RPC22678-20UG,BIM-RPC22678-100UG,BIM-RPC22678-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: NP, Nucleoprotein, Nucleocapsid protein, Protein N
Recombinant Influenza A virus Nucleoprotein (NP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1). Target Name: NP. Target Synonyms: NP, Nucleoprotein, Nucleocapsid protein, Protein N. Accession Number: P03466. Expression Region: 1~498aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 70.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 70.2kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAEFED
Target-Kategorie: NP