Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli

Product Overview

• Article Name: Recombinant Influenza A virus Nucleoprotein (NP), Unconjugated, E. coli
• Biozol Catalog Number: BIM-RPC22678
• Supplier Catalog Number: RPC22678
• Alternative Catalog Number: BIM-RPC22678-20UG,BIM-RPC22678-100UG,BIM-RPC22678-1MG
• Manufacturer: Biomatik Corporation
• Host: E. coli
• Category: Proteine/Peptide
• Species Reactivity: Virus
• Conjugation: Unconjugated
• Alternative Names: NP, Nucleoprotein, Nucleocapsid protein, Protein N

Product Description

Recombinant Influenza A virus Nucleoprotein (NP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Influenza A virus (strain A/Puerto Rico/8/1934 H1N1). Target Name: NP. Target Synonyms: NP, Nucleoprotein, Nucleocapsid protein, Protein N. Accession Number: P03466. Expression Region: 1~498aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 70.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.

Product Properties

• Molecular Weight: 70.2kDa
• Tag: N-Terminal 6Xhis-B2M-Tagged
• Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Purity: >90% by SDS-PAGE
• Sequence: MASQGTKRSYEQMETDGERQNATEIRASVGKMIGGIGRFYIQMCTELKLSDYEGRLIQNSLTIERMVLSAFDERRNKYLEEHPSAGKDPKKTGGPIYRRVNGKWMRELILYDKEEIRRIWRQANNGDDATAGLTHMMIWHSNLNDATYQRTRALVRTGMDPRMCSLMQGSTLPRRSGAAGAAVKGVGTMVMELVRMIKRGINDRNFWRGENGRKTRIAYERMCNILKGKFQTAAQKAMMDQVRESRNPGNAEFED
• Target: NP