Recombinant Bacillus subtilis Levanase (sacC), Unconjugated, E. coli

Artikelnummer: BIM-RPC22692
Artikelname: Recombinant Bacillus subtilis Levanase (sacC), Unconjugated, E. coli
Artikelnummer: BIM-RPC22692
Hersteller Artikelnummer: RPC22692
Alternativnummer: BIM-RPC22692-20UG,BIM-RPC22692-100UG,BIM-RPC22692-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Beta-D-fructofuranosidase, Exo-beta-D-fructosidase, Exo-levanase
Recombinant Bacillus subtilis Levanase (sacC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: sacC. Target Synonyms: Beta-D-fructofuranosidase, Exo-beta-D-fructosidase, Exo-levanase. Accession Number: P05656. Expression Region: 25~677aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 77.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 77.2kDa
Tag: N-Terminal 6Xhis-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKV
Target-Kategorie: sacC