Recombinant Bacillus subtilis Levanase (sacC), Unconjugated, E. coli

Catalog Number: BIM-RPC22692
Article Name: Recombinant Bacillus subtilis Levanase (sacC), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22692
Supplier Catalog Number: RPC22692
Alternative Catalog Number: BIM-RPC22692-20UG,BIM-RPC22692-100UG,BIM-RPC22692-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Beta-D-fructofuranosidase, Exo-beta-D-fructosidase, Exo-levanase
Recombinant Bacillus subtilis Levanase (sacC) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Bacillus subtilis (strain 168). Target Name: sacC. Target Synonyms: Beta-D-fructofuranosidase, Exo-beta-D-fructosidase, Exo-levanase. Accession Number: P05656. Expression Region: 25~677aa. Tag Info: N-Terminal 6Xhis-Tagged. Theoretical MW: 77.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 77.2kDa
Tag: N-Terminal 6Xhis-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ADSSYYDEDYRPQYHFTPEANWMNDPNGMVYYAGEYHLFYQYHPYGLQWGPMHWGHAVSKDLVTWEHLPVALYPDEKGTIFSGSAVVDKNNTSGFQTGKEKPLVAIYTQDREGHQVQSIAYSNDKGRTWTKYAGNPVIPNPGKKDFRDPKVFWYEKEKKWVMVLAAGDRILIYTSKNLKQWTYASEFGQDQGSHGGVWECPDLFELPVDGNPNQKKWVMQVSVGNGAVSGGSGMQYFVGDFDGTHFKNENPPNKV
Target: sacC