Recombinant E. coli Recombination protein RecR (recR), Unconjugated

Artikelnummer: BIM-RPC22721
Artikelname: Recombinant E. coli Recombination protein RecR (recR), Unconjugated
Artikelnummer: BIM-RPC22721
Hersteller Artikelnummer: RPC22721
Alternativnummer: BIM-RPC22721-20UG,BIM-RPC22721-100UG,BIM-RPC22721-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: recR, b0472, JW0461, Recombination protein RecR
Recombinant E. coli Recombination protein RecR (recR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: recR. Target Synonyms: recR, b0472, JW0461, Recombination protein RecR. Accession Number: P0A7H6. Expression Region: 1~201aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 38kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 38kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF
Target-Kategorie: recR