Recombinant E. coli Recombination protein RecR (recR), Unconjugated

Catalog Number: BIM-RPC22721
Article Name: Recombinant E. coli Recombination protein RecR (recR), Unconjugated
Biozol Catalog Number: BIM-RPC22721
Supplier Catalog Number: RPC22721
Alternative Catalog Number: BIM-RPC22721-20UG,BIM-RPC22721-100UG,BIM-RPC22721-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: recR, b0472, JW0461, Recombination protein RecR
Recombinant E. coli Recombination protein RecR (recR) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli (strain K12). Target Name: recR. Target Synonyms: recR, b0472, JW0461, Recombination protein RecR. Accession Number: P0A7H6. Expression Region: 1~201aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 38kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 38kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEGEATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIRF
Target: recR