Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL), Unconjugated

Artikelnummer: BIM-RPC22796
Artikelname: Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL), Unconjugated
Artikelnummer: BIM-RPC22796
Hersteller Artikelnummer: RPC22796
Alternativnummer: BIM-RPC22796-20UG,BIM-RPC22796-100UG,BIM-RPC22796-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: E. coli
Konjugation: Unconjugated
Alternative Synonym: mscL, Z4661, ECs4156, Large-conductance mechanosensitive channel
Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: mscL. Target Synonyms: mscL, Z4661, ECs4156, Large-conductance mechanosensitive channel. Accession Number: P0A743. Expression Region: 1~136aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 29kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 29kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Target-Kategorie: mscL