Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL), Unconjugated

Catalog Number: BIM-RPC22796
Article Name: Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL), Unconjugated
Biozol Catalog Number: BIM-RPC22796
Supplier Catalog Number: RPC22796
Alternative Catalog Number: BIM-RPC22796-20UG,BIM-RPC22796-100UG,BIM-RPC22796-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: E. coli
Conjugation: Unconjugated
Alternative Names: mscL, Z4661, ECs4156, Large-conductance mechanosensitive channel
Recombinant E. coli O157:H7 Large-conductance mechanosensitive channel (mscL) is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: E. coli O157:H7. Target Name: mscL. Target Synonyms: mscL, Z4661, ECs4156, Large-conductance mechanosensitive channel. Accession Number: P0A743. Expression Region: 1~136aa. Tag Info: N-Terminal 6Xhis-B2M-Tagged. Theoretical MW: 29kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 29kDa
Tag: N-Terminal 6Xhis-B2M-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: MSIIKEFREFAMRGNVVDLAVGVIIGAAFGKIVSSLVADIIMPPLGLLIGGIDFKQFAVTLRDAQGDIPAVVMHYGVFIQNVFDFLIVAFAIFMAIKLINKLNRKKEEPAAAPAPTKEEVLLTEIRDLLKEQNNRS
Target: mscL