Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A, Unconjugated, E. coli

Artikelnummer: BIM-RPC22808
Artikelname: Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A, Unconjugated, E. coli
Artikelnummer: BIM-RPC22808
Hersteller Artikelnummer: RPC22808
Alternativnummer: BIM-RPC22808-20UG,BIM-RPC22808-100UG,BIM-RPC22808-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Tendamistat
Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptomyces tendae. Target Name: Streptomyces tendae Alpha-amylase inhibitor HOE-467A. Target Synonyms: Tendamistat. Accession Number: P01092. Expression Region: 31~104aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 28kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL
Target-Kategorie: Streptomyces tendae Alpha-amylase inhibitor HOE-467A