Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A, Unconjugated, E. coli

Catalog Number: BIM-RPC22808
Article Name: Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22808
Supplier Catalog Number: RPC22808
Alternative Catalog Number: BIM-RPC22808-20UG,BIM-RPC22808-100UG,BIM-RPC22808-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Tendamistat
Recombinant Streptomyces tendae Alpha-amylase inhibitor HOE-467A is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Streptomyces tendae. Target Name: Streptomyces tendae Alpha-amylase inhibitor HOE-467A. Target Synonyms: Tendamistat. Accession Number: P01092. Expression Region: 31~104aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 28kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 28kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: DTTVSEPAPSCVTLYQSWRYSQADNGCAQTVTVKVVYEDDTEGLCYAVAPGQITTVGDGYIGSHGHARYLARCL
Target: Streptomyces tendae Alpha-amylase inhibitor HOE-467A