Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22813
Artikelname: Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22813
Hersteller Artikelnummer: RPC22813
Alternativnummer: BIM-RPC22813-20UG,BIM-RPC22813-100UG,BIM-RPC22813-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Konjugation: Unconjugated
Alternative Synonym: H2-D1, H-2 class I histocompatibility antigen, D-D alpha chain, H-2D(D)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: H2-D1. Target Synonyms: H2-D1, H-2 class I histocompatibility antigen, D-D alpha chain, H-2D(D). Accession Number: P01900. Expression Region: 25~311aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 49.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: GSHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEGPEYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESDGRLLRGYWQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPAGDGTFQKWASVVVPLGKEQ
Target-Kategorie: H2-D1