Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22813
Article Name: Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22813
Supplier Catalog Number: RPC22813
Alternative Catalog Number: BIM-RPC22813-20UG,BIM-RPC22813-100UG,BIM-RPC22813-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Mouse
Conjugation: Unconjugated
Alternative Names: H2-D1, H-2 class I histocompatibility antigen, D-D alpha chain, H-2D(D)
Recombinant Mouse H-2 class I histocompatibility antigen, D-D alpha chain (H2-D1), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mouse (Mus musculus). Target Name: H2-D1. Target Synonyms: H2-D1, H-2 class I histocompatibility antigen, D-D alpha chain, H-2D(D). Accession Number: P01900. Expression Region: 25~311aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 49.2kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 49.2kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: GSHSLRYFVTAVSRPGFGEPRYMEVGYVDNTEFVRFDSDAENPRYEPRARWIEQEGPEYWERETRRAKGNEQSFRVDLRTALRYYNQSAGGSHTLQWMAGCDVESDGRLLRGYWQFAYDGCDYIALNEDLKTWTAADMAAQITRRKWEQAGAAERDRAYLEGECVEWLRRYLKNGNATLLRTDPPKAHVTHHRRPEGDVTLRCWALGFYPADITLTWQLNGEELTQEMELVETRPAGDGTFQKWASVVVPLGKEQ
Target: H2-D1