Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A), Unconjugated, E. coli

Artikelnummer: BIM-RPC22832
Artikelname: Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A), Unconjugated, E. coli
Artikelnummer: BIM-RPC22832
Hersteller Artikelnummer: RPC22832
Alternativnummer: BIM-RPC22832-20UG,BIM-RPC22832-100UG,BIM-RPC22832-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Plant
Konjugation: Unconjugated
Alternative Synonym: Pathogenesis related protein 10A, CjPR10A
Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Coptis japonica (Japanese goldthread). Target Name: PR10A. Target Synonyms: Pathogenesis related protein 10A, CjPR10A. Accession Number: A2A1A1. Expression Region: 20~196aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE
Target-Kategorie: PR10A