Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A), Unconjugated, E. coli

Catalog Number: BIM-RPC22832
Article Name: Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22832
Supplier Catalog Number: RPC22832
Alternative Catalog Number: BIM-RPC22832-20UG,BIM-RPC22832-100UG,BIM-RPC22832-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Plant
Conjugation: Unconjugated
Alternative Names: Pathogenesis related protein 10A, CjPR10A
Recombinant Coptis japonica S-norcoclaurine synthase 2 (PR10A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Coptis japonica (Japanese goldthread). Target Name: PR10A. Target Synonyms: Pathogenesis related protein 10A, CjPR10A. Accession Number: A2A1A1. Expression Region: 20~196aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ERLIFNGRPLLHRVTKEETVMLYHELEVAASADEVWSVEGSPELGLHLPDLLPAGIFAKFEITGDGGEGSILDMTFPPGQFPHHYREKFVFFDHKNRYKLVEQIDGDFFDLGVTYYMDTIRVVATGPDSCVIKSTTEYHVKPEFAKIVKPLIDTVPLAIMSEAIAKVVLENKHKSSE
Target: PR10A