Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP), Unconjugated, E. coli

Artikelnummer: BIM-RPC22839
Artikelname: Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP), Unconjugated, E. coli
Artikelnummer: BIM-RPC22839
Hersteller Artikelnummer: RPC22839
Alternativnummer: BIM-RPC22839-20UG,BIM-RPC22839-100UG,BIM-RPC22839-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Endopeptidase Clp
Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A). Target Name: clpP. Target Synonyms: Endopeptidase Clp. Accession Number: A5I6W1. Expression Region: 1~194aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 37.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Target-Kategorie: clpP