Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP), Unconjugated, E. coli

Catalog Number: BIM-RPC22839
Article Name: Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22839
Supplier Catalog Number: RPC22839
Alternative Catalog Number: BIM-RPC22839-20UG,BIM-RPC22839-100UG,BIM-RPC22839-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Endopeptidase Clp
Recombinant Clostridium botulinum ATP-dependent Clp protease proteolytic subunit (clpP) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A). Target Name: clpP. Target Synonyms: Endopeptidase Clp. Accession Number: A5I6W1. Expression Region: 1~194aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 37.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 37.5kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK
Target: clpP