Recombinant Rotavirus A Outer capsid glycoprotein VP7, Unconjugated, E. coli

Artikelnummer: BIM-RPC22852
Artikelname: Recombinant Rotavirus A Outer capsid glycoprotein VP7, Unconjugated, E. coli
Artikelnummer: BIM-RPC22852
Hersteller Artikelnummer: RPC22852
Alternativnummer: BIM-RPC22852-20UG,BIM-RPC22852-100UG,BIM-RPC22852-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: Outer capsid glycoprotein VP7, Fragment
Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A). Target Name: Rotavirus A Outer capsid glycoprotein VP7. Target Synonyms: Outer capsid glycoprotein VP7, Fragment. Accession Number: A8D8S8. Expression Region: 34~309aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 36kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >85% by SDS-PAGE
Sequenz: QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQ
Target-Kategorie: Rotavirus A Outer capsid glycoprotein VP7