Recombinant Rotavirus A Outer capsid glycoprotein VP7, Unconjugated, E. coli

Catalog Number: BIM-RPC22852
Article Name: Recombinant Rotavirus A Outer capsid glycoprotein VP7, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22852
Supplier Catalog Number: RPC22852
Alternative Catalog Number: BIM-RPC22852-20UG,BIM-RPC22852-100UG,BIM-RPC22852-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: Outer capsid glycoprotein VP7, Fragment
Recombinant Rotavirus A Outer capsid glycoprotein VP7 is a purified Recombinant Protein. Purity: >85% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Rotavirus A (strain RVA/Cow/Canada/C486/1977/G6P6[1]) (RV-A). Target Name: Rotavirus A Outer capsid glycoprotein VP7. Target Synonyms: Outer capsid glycoprotein VP7, Fragment. Accession Number: A8D8S8. Expression Region: 34~309aa. Tag Info: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 36kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 36kDa
Tag: N-Terminal 10Xhis-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >85% by SDS-PAGE
Sequence: QNYGVNLPITGSMDTAYANSTQSEPFLTSTLCLYYPVEASNEIADTEWKDTLSQLFLTKGWPTGSVYLKEYADIAAFSVEPQLYCDYNLVLMKYDSTQELDMSELADLILNEWLCNPMDITLYYYQQTDEANKWISMGSSCTVKVCPLNTQTLGIGCLITNPDTFETVATTEKLVITDVVDGVSHKLNVTTATCTIRNCKKLGPKENVAVIQVGGANILDITADPTTTPQTERMMAIIWKKWWQVVYPVVDYVNQ
Target: Rotavirus A Outer capsid glycoprotein VP7