Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial, Unconjugated, E. coli

Artikelnummer: BIM-RPC22859
Artikelname: Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial, Unconjugated, E. coli
Artikelnummer: BIM-RPC22859
Hersteller Artikelnummer: RPC22859
Alternativnummer: BIM-RPC22859-20UG,BIM-RPC22859-100UG,BIM-RPC22859-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: Lysine-specific cysteine proteinase Kgp
Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257). Target Name: kgp. Target Synonyms: Lysine-specific cysteine proteinase Kgp. Accession Number: B2RLK2. Expression Region: 229~594aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 56.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWKAQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDGLAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYYSAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYEKATMPDKSYLEKALLIAGADSYWNPKIGQQTIKYAVQYYYNQDHGYTDVYSYPKAPYTGCYSHLNTGVGFANYTAHGSETSWADPSLTATQVKALTNKDKYFLAIGNCCVTAQFD
Target-Kategorie: kgp