Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial, Unconjugated, E. coli

Catalog Number: BIM-RPC22859
Article Name: Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial, Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22859
Supplier Catalog Number: RPC22859
Alternative Catalog Number: BIM-RPC22859-20UG,BIM-RPC22859-100UG,BIM-RPC22859-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: Lysine-specific cysteine proteinase Kgp
Recombinant Porphyromonas gingivalis Lys-gingipain (kgp), partial is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257). Target Name: kgp. Target Synonyms: Lysine-specific cysteine proteinase Kgp. Accession Number: B2RLK2. Expression Region: 229~594aa. Tag Info: N-Terminal 6Xhis-Sumo-Tagged. Theoretical MW: 56.6kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 56.6kDa
Tag: N-Terminal 6Xhis-Sumo-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: DVYTDHGDLYNTPVRMLVVAGAKFKEALKPWLTWKAQKGFYLDVHYTDEAEVGTTNASIKAFIHKKYNDGLAASAAPVFLALVGDTDVISGEKGKKTKKVTDLYYSAVDGDYFPEMYTFRMSASSPEELTNIIDKVLMYEKATMPDKSYLEKALLIAGADSYWNPKIGQQTIKYAVQYYYNQDHGYTDVYSYPKAPYTGCYSHLNTGVGFANYTAHGSETSWADPSLTATQVKALTNKDKYFLAIGNCCVTAQFD
Target: kgp