Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1), Unconjugated, E. coli

Artikelnummer: BIM-RPC22877
Artikelname: Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1), Unconjugated, E. coli
Artikelnummer: BIM-RPC22877
Hersteller Artikelnummer: RPC22877
Alternativnummer: BIM-RPC22877-20UG,BIM-RPC22877-100UG,BIM-RPC22877-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Bacteria
Konjugation: Unconjugated
Alternative Synonym: hrp1, Rv2626cHypoxic response protein 1, HRP1
Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Target Name: hrp1. Target Synonyms: hrp1, Rv2626cHypoxic response protein 1, HRP1. Accession Number: P9WJA3. Expression Region: 1~143aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 35.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Target-Kategorie: hrp1