Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1), Unconjugated, E. coli

Catalog Number: BIM-RPC22877
Article Name: Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22877
Supplier Catalog Number: RPC22877
Alternative Catalog Number: BIM-RPC22877-20UG,BIM-RPC22877-100UG,BIM-RPC22877-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Bacteria
Conjugation: Unconjugated
Alternative Names: hrp1, Rv2626cHypoxic response protein 1, HRP1
Recombinant Mycobacterium tuberculosis Hypoxic response protein 1 (hrp1) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv). Target Name: hrp1. Target Synonyms: hrp1, Rv2626cHypoxic response protein 1, HRP1. Accession Number: P9WJA3. Expression Region: 1~143aa. Tag Info: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged. Theoretical MW: 35.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 35.5kDa
Tag: N-Terminal 10Xhis-Sumo-Tagged And C-Terminal Myc-Tagged
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: MTTARDIMNAGVTCVGEHETLTAAAQYMREHDIGALPICGDDDRLHGMLTDRDIVIKGLAAGLDPNTATAGELARDSIYYVDANASIQEMLNVMEEHQVRRVPVISEHRLVGIVTEADIARHLPEHAIVQFVKAICSPMALAS
Target: hrp1