Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A), Unconjugated, E. coli

Artikelnummer: BIM-RPC22881
Artikelname: Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A), Unconjugated, E. coli
Artikelnummer: BIM-RPC22881
Hersteller Artikelnummer: RPC22881
Alternativnummer: BIM-RPC22881-20UG,BIM-RPC22881-100UG,BIM-RPC22881-1MG
Hersteller: Biomatik Corporation
Wirt: E. coli
Kategorie: Proteine/Peptide
Spezies Reaktivität: Virus
Konjugation: Unconjugated
Alternative Synonym: UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10
Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5). Target Name: UL111A. Target Synonyms: UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10. Accession Number: F5HC71. Expression Region: 26~176aa. Tag Info: Tag-Free. Theoretical MW: 17.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molekulargewicht: 17.5kDa
Tag: Tag-Free
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reinheit: >90% by SDS-PAGE
Sequenz: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Target-Kategorie: UL111A