Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A), Unconjugated, E. coli

Catalog Number: BIM-RPC22881
Article Name: Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A), Unconjugated, E. coli
Biozol Catalog Number: BIM-RPC22881
Supplier Catalog Number: RPC22881
Alternative Catalog Number: BIM-RPC22881-20UG,BIM-RPC22881-100UG,BIM-RPC22881-1MG
Manufacturer: Biomatik Corporation
Host: E. coli
Category: Proteine/Peptide
Species Reactivity: Virus
Conjugation: Unconjugated
Alternative Names: UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10
Recombinant Human cytomegalovirus Viral interleukin-10 homolog (UL111A) is a purified Recombinant Protein. Purity: >90% as determined by SDS-PAGE. Host: E. coli. Endotoxin Level: Not Tested. Species: Human cytomegalovirus (strain Merlin) (HHV-5) (Human herpesvirus 5). Target Name: UL111A. Target Synonyms: UL111A, Viral interleukin-10 homolog, cmvIL-10, vIL-10. Accession Number: F5HC71. Expression Region: 26~176aa. Tag Info: Tag-Free. Theoretical MW: 17.5kDa. Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. Storage: -20C. Avoid repeated freeze/thaw cycles. Restrictions: For Research Use Only. Not for use in diagnostic procedures.
Molecular Weight: 17.5kDa
Tag: Tag-Free
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Purity: >90% by SDS-PAGE
Sequence: ATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPTLQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLESIYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
Target: UL111A